PDB entry 1kft

View 1kft on RCSB PDB site
Description: Solution Structure of the C-Terminal domain of UvrC from E-coli
Class: DNA binding protein
Keywords: helix-hairpin-helix, HhH domain, DNA-binding domain, DNA BINDING PROTEIN
Deposited on 2001-11-23, released 2002-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excinuclease ABC subunit C
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kfta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kftA (A:)
    mgsshhhhhhssglvprgshmntssletiegvgpkrrqmllkymgglqglrnasveeiak
    vpgisqglaekifwslkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kftA (A:)
    tssletiegvgpkrrqmllkymgglqglrnasveeiakvpgisqglaekifwslkh