PDB entry 1kfs

View 1kfs on RCSB PDB site
Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex
Deposited on 1997-08-18, released 1998-02-25
The last revision prior to the SCOP 1.67 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kfsA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfsA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvi
    leyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegr
    rirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfglple
    tvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertra
    qakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawl
    qaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqa
    h