PDB entry 1kfs

View 1kfs on RCSB PDB site
Description: DNA polymerase I klenow fragment (e.c.2.7.7.7) mutant/DNA complex
Class: transferase/DNA
Keywords: complex (hydrolase/DNA), exonuclease, phosphorothioate, transferase/DNA complex
Deposited on 1997-08-18, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA polymerase I klenow fragment (e.c.2.7.7.7))
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00582 (0-604)
      • engineered (0)
    Domains in SCOPe 2.07: d1kfsa1, d1kfsa2
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*tp*tp*ap*cp*g)-3')
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kfsA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfsA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvi
    leyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegr
    rirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfglple
    tvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertra
    qakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawl
    qaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqa
    h
    

  • Chain 'B':
    No sequence available.