PDB entry 1kfr

View 1kfr on RCSB PDB site
Description: Structural plasticity in the eight-helix fold of a trematode hemoglobin
Deposited on 2001-11-22, released 2002-04-24
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1kfra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kfrA (A:)
tltkheqdillkelgphvdtpahivetglgayhalftahpqyishfsrleghtienvmqs
dgikhyartlteaivhmlkeisndaevkkiaaqygkdhtsrkvtkdefmsgepiftkyfq
nlvadaegkaavekflkhvfpmmaaei