PDB entry 1kfn

View 1kfn on RCSB PDB site
Description: Core side-chain packing and backbone conformation in Lpp-56 coiled-coil mutants
Class: membrane protein
Keywords: lipoprotein, protein folding, helix capping, alanine-zipper, membrane protein
Deposited on 2001-11-21, released 2002-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.244
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major outer membrane lipoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69776 (0-End)
      • engineered (22)
      • engineered (26)
      • engineered (29)
      • engineered (33)
    Domains in SCOPe 2.08: d1kfna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kfnA (A:)
    ssnakidqlssdvqtlnakvdqasndanaarsdaqaakddaaranqrldnmatkyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfnA (A:)
    ssnakidqlssdvqtlnakvdqasndanaarsdaqaakddaaranqrldnmat