PDB entry 1kfl

View 1kfl on RCSB PDB site
Description: Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from E.coli complexed with Mn2+, PEP, and Phe
Class: lyase
Keywords: beta/alpha barrel, allosteric inhibition, feedback regulation, aromatic biosynthetic pathway, LYASE
Deposited on 2001-11-21, released 2002-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kfla1, d1kfla2
  • Chain 'B':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kflb1, d1kflb2
  • Chain 'C':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kflc1, d1kflc2
  • Chain 'D':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kfld1, d1kfld2
  • Chain 'E':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kfle1, d1kfle2
  • Chain 'F':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kflf1, d1kflf2
  • Chain 'G':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kflg1, d1kflg2
  • Chain 'H':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00886 (0-349)
      • cloning artifact (0)
      • cloning artifact (90)
      • cloning artifact (112)
      • cloning artifact (146)
      • cloning artifact (156)
      • cloning artifact (262)
      • cloning artifact (278)
      • cloning artifact (299)
    Domains in SCOPe 2.06: d1kflh1, d1kflh2
  • Heterogens: MN, SO4, PHE, PEP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflA (A:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflB (B:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflC (C:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflD (D:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflE (E:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflF (F:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflG (G:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kflH (H:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg