PDB entry 1kfa

View 1kfa on RCSB PDB site
Description: Crystal structure of Fab fragment complexed with gibberellin A4
Class: immune system
Keywords: Immunoglobuiln fold, IMMUNE SYSTEM
Deposited on 2001-11-20, released 2002-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.235
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KFA (Start-220)
    Domains in SCOPe 2.05: d1kfah1, d1kfah2
  • Chain 'I':
    Compound: monoclonal antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KFA
    Domains in SCOPe 2.05: d1kfai1, d1kfai2
  • Chain 'L':
    Compound: monoclonal antibody light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KFA (0-216)
    Domains in SCOPe 2.05: d1kfal1, d1kfal2
  • Chain 'M':
    Compound: monoclonal antibody light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KFA (0-End)
    Domains in SCOPe 2.05: d1kfam1, d1kfam2
  • Heterogens: GA4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kfaH (H:)
    evmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfyp
    dsvkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss
    akttppsvyplapxxxxxxxsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsssrpsetvtcnvahpasstkvdkkivpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfaH (H:)
    vmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypd
    svkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvssa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsssrpsetvtcnvahpasstkvdkkivpad
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kfaI (I:)
    evmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfyp
    dsvkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss
    akttppsvyplapxxxxxxxsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsssrpsetvtcnvahpasstkvdkkivpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfaI (I:)
    mlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypds
    vkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvssak
    ttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
    psssrpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfaL (L:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
    sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradagptv
    ssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhasytceaahktstspiaksfnra
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kfaM (M:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
    sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradagptv
    ssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhasytceaahktstspiaksfnra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfaM (M:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
    sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradagptv
    ssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhasytceaahktstspiaks