PDB entry 1kfa

View 1kfa on RCSB PDB site
Description: Crystal structure of Fab fragment complexed with gibberellin A4
Deposited on 2001-11-20, released 2002-09-11
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-11, with a file datestamp of 2002-09-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.235
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kfaH (H:)
    evmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfyp
    dsvkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss
    akttppsvyplapxxxxxxxsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsssrpsetvtcnvahpasstkvdkkivpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfaH (H:)
    vmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypd
    svkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvssa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsssrpsetvtcnvahpasstkvdkkivpad
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kfaI (I:)
    evmlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfyp
    dsvkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss
    akttppsvyplapxxxxxxxsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsssrpsetvtcnvahpasstkvdkkivpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfaI (I:)
    mlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypds
    vkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvssak
    ttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
    psssrpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfaL (L:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
    sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradagptv
    ssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhasytceaahktstspiaksfnra
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kfaM (M:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
    sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradagptv
    ssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhasytceaahktstspiaksfnra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfaM (M:)
    dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
    sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradagptv
    ssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhasytceaahktstspiaks