PDB entry 1kf8

View 1kf8 on RCSB PDB site
Description: Atomic resolution structure of RNase A at pH 8.8
Class: hydrolase
Keywords: RNase A, titration, pH, crystal, soaking, HYDROLASE
Deposited on 2001-11-19, released 2001-12-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.106
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic Ribonuclease
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1kf8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf8A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv