PDB entry 1kf5

View 1kf5 on RCSB PDB site
Description: Atomic Resolution Structure of RNase A at pH 7.1
Class: hydrolase
Keywords: RNase A, titration, pH, crystal, soaking, HYDROLASE
Deposited on 2001-11-19, released 2001-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.106
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pancreatic Ribonuclease
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.07: d1kf5a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kf5A (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv