PDB entry 1kf0

View 1kf0 on RCSB PDB site
Description: Crystal Structure of Pig Muscle Phosphoglycerate Kinase Ternary Complex with AMP-PCP and 3PG
Class: transferase
Keywords: ATP analogue, TRANSFERASE
Deposited on 2001-11-19, released 2002-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.173
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kf0a_
  • Heterogens: MG, 3PG, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf0A (A:)
    slsnkltldklnvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfclddgaksvvlm
    shlgrpdgspmpdkyslqpvavelksllgkdvlflkdcvgpevekacadpaagsvillen
    lrfhveeegkgkdasgnkvkaepakiktfraslsklgdvyvndafgtahrahssmvgvnl
    pkkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
    ftflkvlnnmeigtslfdeegakivknlmskaekngvkitlpvdfvtadkfdehaktgqa
    tvasgipagwmgldcgpesskkyseavarakqivwngpvgvfeweafaqgtkalmdevvk
    atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv