PDB entry 1key

View 1key on RCSB PDB site
Description: Crystal Structure of Mouse Testis/Brain RNA-binding Protein (TB-RBP)
Class: RNA binding protein
Keywords: RNA-binding protein, tetramer/octamer assembly, apoTB-RBP, RNA BINDING PROTEIN
Deposited on 2001-11-19, released 2002-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.247
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1keya_
  • Chain 'B':
    Compound: Translin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62348 (7-End)
      • cloning artifact (4-6)
    Domains in SCOPe 2.06: d1keyb1, d1keyb2
  • Chain 'C':
    Compound: Translin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1keyc_
  • Chain 'D':
    Compound: Translin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1keyd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1keyA (A:)
    gspefatmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqd
    ipkrclkarehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetl
    vtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistf
    ineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacgek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1keyA (A:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhdipkrclkarehfs
    tvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgie
    pdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrllnl
    kndslrkrydglkydvkkveevvydlsirgfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1keyB (B:)
    gspefatmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqd
    ipkrclkarehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetl
    vtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistf
    ineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacgek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1keyB (B:)
    fatmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqdipkr
    clkarehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtre
    avteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfinel
    dsgfrllnlkndslrkrydglkydvkkveevvydlsirgfn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1keyC (C:)
    gspefatmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqd
    ipkrclkarehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetl
    vtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistf
    ineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacgek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1keyC (C:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvdipkrclkarehfst
    vkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgiep
    drekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrllnlk
    ndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1keyD (D:)
    gspefatmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqd
    ipkrclkarehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetl
    vtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistf
    ineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacgek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1keyD (D:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkarehf
    stvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi
    epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln
    lkndslrkrydglkydvkkveevvydlsirg