PDB entry 1kev

View 1kev on RCSB PDB site
Description: structure of nadp-dependent alcohol dehydrogenase
Deposited on 1996-10-21, released 1997-10-22
The last revision prior to the SCOP 1.61 freeze date was dated 1997-10-22, with a file datestamp of 1997-10-22.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kevA (A:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kevB (B:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kevC (C:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kevD (D:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil