PDB entry 1ker

View 1ker on RCSB PDB site
Description: The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Streptococcus suis with dTDP-D-glucose bound
Class: lyase
Keywords: Rossmann fold, LYASE
Deposited on 2001-11-17, released 2002-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-d-glucose 4,6-dehydratase
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Gene: RMLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kera_
  • Chain 'B':
    Compound: dtdp-d-glucose 4,6-dehydratase
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Gene: RMLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kerb_
  • Heterogens: SO4, DAU, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kerA (A:)
    msqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvv
    gdiadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirf
    hhvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfg
    vkatisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwai
    ltkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrd
    elgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kerA (A:)
    qfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvgd
    iadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfhh
    vstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgvk
    atisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwailt
    kgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrdel
    gwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kerB (B:)
    msqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvv
    gdiadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirf
    hhvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfg
    vkatisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwai
    ltkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrd
    elgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kerB (B:)
    sqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvg
    diadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfh
    hvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgv
    katisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwail
    tkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrde
    lgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik