PDB entry 1kem

View 1kem on RCSB PDB site
Description: catalytic antibody 28b4 fab fragment
Class: catalytic antibody
Keywords: sulfide oxidation, monooxygenase, oxygenation, fab, immunoglobulin, catalytic antibody
Deposited on 1996-04-16, released 1996-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 1996-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 28b4 fab
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kemh1, d1kemh2
  • Chain 'L':
    Compound: 28b4 fab
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-216)
      • conflict (24)
      • conflict (31)
      • conflict (44)
    Domains in SCOP 1.75: d1keml1, d1keml2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kemH (H:)
    evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kemL (L:)
    dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn