PDB entry 1kel

View 1kel on RCSB PDB site
Description:
Deposited on 1996-04-16, released 1996-12-07
The last revision prior to the SCOP 1.57 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1kelh1, d1kelh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1kell1, d1kell2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kelH (H:)
    evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kelL (L:)
    dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn