PDB entry 1kel

View 1kel on RCSB PDB site
Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)
Class: catalytic antibody
Keywords: sulfide oxidation, monooxygenase, oxygenation, fab, immunoglobulin, catalytic antibody
Deposited on 1996-04-16, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 28b4 fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kelh1, d1kelh2
  • Chain 'L':
    Compound: 28b4 fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-216)
      • conflict (24)
      • conflict (31)
      • conflict (44)
    Domains in SCOPe 2.07: d1kell1, d1kell2
  • Heterogens: AAH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kelH (H:)
    evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kelL (L:)
    dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn