PDB entry 1kek

View 1kek on RCSB PDB site
Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase
Class: oxidoreductase
Keywords: homodimer, 7 domains, OXIDOREDUCTASE
Deposited on 2001-11-16, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate-ferredoxin oxidoreductase
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1keka1, d1keka2, d1keka3, d1keka4, d1keka5
  • Chain 'B':
    Compound: pyruvate-ferredoxin oxidoreductase
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kekb1, d1kekb2, d1kekb3, d1kekb4, d1kekb5
  • Heterogens: MG, CA, SF4, HTL, CO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kekA (A:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kekB (B:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk