PDB entry 1ked

View 1ked on RCSB PDB site
Description: human transthyretin (also called prealbumin) complex with 3,3',5,5'-tetraiodothyroacetic acid (t4ac)
Class: transport protein
Keywords: albumin, transport, retinol-binding, vitamin a, amyloid, thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, polymorphism, disease mutation, tetraiodothyroacetic acid, t4ac, prealbumin
Deposited on 2001-11-15, released 2002-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-06-07, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1keda_
  • Chain 'B':
    Compound: Transthyretin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kedb_
  • Heterogens: T4A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kedA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kedA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kedB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kedB (B:)
    skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefveg
    iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp