PDB entry 1kea

View 1kea on RCSB PDB site
Description: structure of a thermostable thymine-DNA glycosylase
Class: hydrolase
Keywords: DNA Repair, DNA Glycosylase, DNA Mismatch, Methylation, Base Twisting, HYDROLASE
Deposited on 2001-11-14, released 2002-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Possible G-T mismatches repair enzyme
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1keaa_
  • Heterogens: ZN, ACT, CL, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1keaA (A:)
    mddatnkkrkvfvstiltfwntdrrdfpwrhtrdpyviliteillrrttaghvkkiydkf
    fvkykcfedilktpkseiakdikeiglsnqraeqlkelarvvindyggrvprnrkaildl
    pgvgkytcaavmclafgkkaamvdanfvrvinryfggsyenlnynhkalwelaetlvpgg
    kcrdfnlglmdfsaiicaprkpkcekcgmsklcsyyekcst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1keaA (A:)
    datnkkrkvfvstiltfwntdrrdfpwrhtrdpyviliteillrrttaghvkkiydkffv
    kykcfedilktpkseiakdikeiglsnqraeqlkelarvvindyggrvprnrkaildlpg
    vgkytcaavmclafgkkaamvdanfvrvinryfggsyenlnynhkalwelaetlvpggkc
    rdfnlglmdfsaiicaprkpkcekcgmsklcsyyekc