PDB entry 1kdx

View 1kdx on RCSB PDB site
Description: kix domain of mouse cbp (creb binding protein) in complex with phosphorylated kinase inducible domain (pkid) of rat creb (cyclic amp response element binding protein), nmr 17 structures
Class: transcription regulation complex
Keywords: complex (transcription activator/co-activator), protein-protein interaction, phosphoserine recognition, transcription regulation complex
Deposited on 1997-09-16, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cbp
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kdxa_
  • Chain 'B':
    Compound: creb
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15337 (0-27)
      • engineered (14)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kdxA (A:)
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkelee

  • Chain 'B':
    No sequence available.