PDB entry 1kdu

View 1kdu on RCSB PDB site
Description: sequential 1h nmr assignments and secondary structure of the kringle domain from urokinase
Class: plasminogen activation
Keywords: plasminogen activation
Deposited on 1993-07-15, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kdua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kduA (A:)
    tcyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnr
    rrpwcyvqvglkplvqecmvhdcad