PDB entry 1kdt

View 1kdt on RCSB PDB site
Description: cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
Class: transferase
Keywords: nucleotide monophosphate kinase, transferase
Deposited on 2001-11-13, released 2002-01-22
The last revision prior to the SCOP 1.75 freeze date was dated 2002-01-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.221
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Escherichia coli
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kdta_
  • Chain 'B':
    Compound: Cytidylate kinase
    Species: Escherichia coli
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kdtb_
  • Heterogens: SO4, DOC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kdtA (A:)
    mtaiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedal
    vplashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqraf
    relpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeike
    rddrdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdtA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqkla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kdtB (B:)
    mtaiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedal
    vplashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqraf
    relpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeike
    rddrdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdtB (B:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqkla