PDB entry 1kdr

View 1kdr on RCSB PDB site
Description: cytidine monophosphate kinase from e.coli in complex with ara-cytidine monophosphate
Class: transferase
Keywords: nucleotide monophosphate kinase, transferase
Deposited on 2001-11-13, released 2002-01-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.199
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kdra_
  • Chain 'B':
    Compound: Cytidylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kdrb_
  • Heterogens: SO4, CAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kdrA (A:)
    mtaiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedal
    vplashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqraf
    relpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeike
    rddrdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdrA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kdrB (B:)
    mtaiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedal
    vplashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqraf
    relpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeike
    rddrdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdrB (B:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqk