PDB entry 1kdq

View 1kdq on RCSB PDB site
Description: Crystal Structure Analysis of the Mutant S189D Rat Chymotrypsin
Class: hydrolase
Keywords: beta barrel, hydrolase
Deposited on 2001-11-13, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin b, b chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07338 (Start-130)
      • engineered (106)
    Domains in SCOPe 2.07: d1kdq.1
  • Chain 'B':
    Compound: chymotrypsin b, c chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07338 (Start-98)
      • engineered (42)
    Domains in SCOPe 2.07: d1kdq.1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kdqA (A:)
    ivngedaipgswpwqvslqdktgfhfcggslisedwvvtaahcgvktsdvvvagefdqgs
    deeniqvlkiaqvfknpkfnmftvrnditllklatpaqfsetvsavslpnvdddfppgtv
    cattgwgktky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdqA (A:)
    vngedaipgswpwqvslqdktgfhfcggslisedwvvtaahcgvktsdvvvagefdqgsd
    eeniqvlkiaqvfknpkfnmftvrnditllklatpaqfsetvsavslpnvdddfppgtvc
    attgwgktky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kdqB (B:)
    nalktpeklqqaalpivseadckkswgskitdvmtcagasgvdscmgdsggplvcqkdgv
    wtlagivswgsgvcststpavysrvtalmpwvqqilean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdqB (B:)
    tpeklqqaalpivseadckkswgskitdvmtcagasgvdscmgdsggplvcqkdgvwtla
    givswgsgvcststpavysrvtalmpwvqqilean