PDB entry 1kdn

View 1kdn on RCSB PDB site
Description: structure of nucleoside diphosphate kinase
Deposited on 1996-09-10, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1kdna_
  • Chain 'B':
    Domains in SCOP 1.55: d1kdnb_
  • Chain 'C':
    Domains in SCOP 1.55: d1kdnc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kdnA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kdnB (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kdnC (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye