PDB entry 1kdk

View 1kdk on RCSB PDB site
Description: the structure of the n-terminal lg domain of shbg in crystals soaked with edta
Class: transport protein
Keywords: shbg, dht, transport protein
Deposited on 2001-11-13, released 2002-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sex hormone-binding globulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04278 (0-176)
    • insertion (0)
    • insertion (118-123)
  Domains in SCOPe 2.05: d1kdka_
• Heterogens: DHT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kdkA (A:)
  dppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlgl
  rdgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgpl
  tskrhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc