PDB entry 1kdj

View 1kdj on RCSB PDB site
Description: oxidized form of plastocyanin from dryopteris crassirhizoma
Deposited on 1998-05-08, released 1999-05-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.234
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1kdj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kdj_ (-)
    akvevgdevgnfkfypdsitvsageaveftlvgetghnivfdipagapgtvaselkaasm
    dendllsedepsfkakvstpgtytfyctphksanmkgtltvk