PDB entry 1kdi

View 1kdi on RCSB PDB site
Description: reduced form of plastocyanin from dryopteris crassirhizoma
Deposited on 1998-05-08, released 1999-05-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1kdi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kdi_ (-)
    akvevgdevgnfkfypdsitvsageaveftlvgetghnivfdipagapgtvaselkaasm
    dendllsedepsfkakvstpgtytfyctphksanmkgtltvk