PDB entry 1kdb

View 1kdb on RCSB PDB site
Description: stabilization of a strained protein loop conformation through protein engineering
Class: hydrolase (phosphoric diester)
Keywords: hydrolase (phosphoric diester)
Deposited on 1994-08-25, released 1995-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • conflict (115)
    Domains in SCOPe 2.05: d1kdba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kdbA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvyepnnt
    heqhlrkseaqakkeklniwsendadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdbA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvyepnntheqhl
    rkseaqakkeklniwse