PDB entry 1kda

View 1kda on RCSB PDB site
Description: stabilization of a strained protein loop conformation through protein engineering
Deposited on 1994-08-25, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1kda__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kda_ (-)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvydpnntheqhl
    rkseaqakkeklniwse