PDB entry 1kd6

View 1kd6 on RCSB PDB site
Description: Solution structure of the eukaryotic pore-forming cytolysin equinatoxin II
Class: membrane protein
Keywords: cytolysin, pore formation, beta sandwich, toxin, sea anemone, MEMBRANE PROTEIN
Deposited on 2001-11-12, released 2002-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: equinatoxin II
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61914 (0-178)
      • see remark 999 (176)
    Domains in SCOPe 2.07: d1kd6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd6A (A:)
    sadvagavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdiv
    lphkvphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvr
    iykgkrradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvtka