PDB entry 1kd1

View 1kd1 on RCSB PDB site
Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
Deposited on 2001-11-12, released 2002-07-19
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-19, with a file datestamp of 2002-07-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.61: d1kd11_
  • Chain '2':
    Domains in SCOP 1.61: d1kd12_
  • Chain '3':
    Domains in SCOP 1.61: d1kd13_
  • Chain '4':
    Domains in SCOP 1.61: d1kd14_
  • Chain 'C':
    Domains in SCOP 1.61: d1kd1c1, d1kd1c2
  • Chain 'D':
    Domains in SCOP 1.61: d1kd1d_
  • Chain 'E':
    Domains in SCOP 1.61: d1kd1e_
  • Chain 'F':
    Domains in SCOP 1.61: d1kd1f_
  • Chain 'G':
    Domains in SCOP 1.61: d1kd1g1, d1kd1g2
  • Chain 'H':
    Domains in SCOP 1.61: d1kd1h_
  • Chain 'I':
    Domains in SCOP 1.61: d1kd1i_
  • Chain 'J':
    Domains in SCOP 1.61: d1kd1j_
  • Chain 'K':
    Domains in SCOP 1.61: d1kd1k_
  • Chain 'L':
    Domains in SCOP 1.61: d1kd1l_
  • Chain 'M':
    Domains in SCOP 1.61: d1kd1m_
  • Chain 'N':
    Domains in SCOP 1.61: d1kd1n_
  • Chain 'O':
    Domains in SCOP 1.61: d1kd1o_
  • Chain 'P':
    Domains in SCOP 1.61: d1kd1p_
  • Chain 'Q':
    Domains in SCOP 1.61: d1kd1q_
  • Chain 'R':
    Domains in SCOP 1.61: d1kd1r_
  • Chain 'S':
    Domains in SCOP 1.61: d1kd1s_
  • Chain 'T':
    Domains in SCOP 1.61: d1kd1t_
  • Chain 'U':
    Domains in SCOP 1.61: d1kd1u_
  • Chain 'V':
    Domains in SCOP 1.61: d1kd1v_
  • Chain 'W':
    Domains in SCOP 1.61: d1kd1w_
  • Chain 'X':
    Domains in SCOP 1.61: d1kd1x_
  • Chain 'Y':
    Domains in SCOP 1.61: d1kd1y_
  • Chain 'Z':
    Domains in SCOP 1.61: d1kd1z_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd11 (1:)
    rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
    qpetvagkavmka
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd12 (2:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1kd13 (3:)
    gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kd13 (3:)
    gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd14 (4:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1C (C:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrgg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1D (D:)
    pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
    pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
    pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
    ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
    pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
    vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1E (E:)
    mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kd1F (F:)
    fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
    gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
    vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kd1F (F:)
    fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
    lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
    hrlnpadavafiestydvev
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1G (G:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1H (H:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kd1I (I:)
    ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
    dd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kd1I (I:)
    ipewkqeevdaivemiesrntlleraldd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1kd1J (J:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
    taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kd1J (J:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
    fiawvnpdpnveeawrrakmkvtptinidsspagna
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1K (K:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1L (L:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kd1M (M:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
    iaddfsegarekvegaggsveltdlgeerq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kd1M (M:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
    segarekvegaggsveltdlgeerq
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1N (N:)
    arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
    ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
    gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
    ekvrpslrvngaka
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1O (O:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1P (P:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1Q (Q:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryida
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1R (R:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1S (S:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileep
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1T (T:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasri
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1U (U:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1V (V:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1W (W:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1X (X:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1Y (Y:)
    ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
    pskirvraarfeeegeaiveae
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd1Z (Z:)
    telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
    rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
    erieeeaedagirvlnptyvev