PDB entry 1kd0

View 1kd0 on RCSB PDB site
Description:
Deposited on 2001-11-12, released 2001-12-19
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-19, with a file datestamp of 2001-12-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1kd0a1, d1kd0a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1kd0b1, d1kd0b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd0A (A:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd0B (B:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrk