PDB entry 1kd0

View 1kd0 on RCSB PDB site
Description: Crystal Structure of beta-methylaspartase from Clostridium tetanomorphum. Apo-structure.
Class: lyase
Keywords: beta zigzag, alpha/beta-barrel, LYASE
Deposited on 2001-11-12, released 2001-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-methylaspartase
    Species: Clostridium tetanomorphum [TaxId:1553]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05514 (0-412)
      • modified residue (0)
      • modified residue (111)
      • modified residue (118)
      • modified residue (149)
      • modified residue (183)
      • modified residue (253)
      • modified residue (275)
      • modified residue (284)
      • modified residue (287)
      • modified residue (326)
      • modified residue (345)
      • modified residue (352)
      • modified residue (375)
      • modified residue (388)
      • modified residue (394-395)
      • modified residue (401)
    Domains in SCOPe 2.07: d1kd0a1, d1kd0a2
  • Chain 'B':
    Compound: beta-methylaspartase
    Species: Clostridium tetanomorphum [TaxId:1553]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05514 (0-412)
      • modified residue (0)
      • modified residue (111)
      • modified residue (118)
      • modified residue (149)
      • modified residue (183)
      • modified residue (253)
      • modified residue (275)
      • modified residue (284)
      • modified residue (287)
      • modified residue (326)
      • modified residue (345)
      • modified residue (352)
      • modified residue (375)
      • modified residue (388)
      • modified residue (394-395)
      • modified residue (401)
    Domains in SCOPe 2.07: d1kd0b1, d1kd0b2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd0A (A:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kd0B (B:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrk