PDB entry 1kcz

View 1kcz on RCSB PDB site
Description:
Deposited on 2001-11-12, released 2001-12-19
The last revision prior to the SCOP 1.71 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.137
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1kcza1, d1kcza2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1kczb1, d1kczb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kczA (A:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kczB (B:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrk