PDB entry 1kcx

View 1kcx on RCSB PDB site
Description: X-ray structure of NYSGRC target T-45
Class: signaling protein
Keywords: alpha/beta barrel, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2001-11-11, released 2003-08-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropyrimidinase related protein-1
    Species: MUS MUSCULUS
    Gene: crmp1 (8-525)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kcxa1, d1kcxa2
  • Chain 'B':
    Compound: dihydropyrimidinase related protein-1
    Species: MUS MUSCULUS
    Gene: crmp1 (8-525)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kcxb1, d1kcxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcxA (A:)
    siphitsdrllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvip
    ggidvntylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaa
    dtksccdyslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftf
    lkglgavilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrin
    cpvyitkvmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtsppl
    spdpttpdyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwd
    kavatgkmdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshks
    tveynifegmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirsk
    vfglhsvsrgmydgpvyevpatpkhaapapsaksspsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcxA (A:)
    drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvipggidvnt
    ylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaadtksccd
    yslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftflkglgav
    ilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrincpvyitk
    vmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtspplspdpttp
    dyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwdkavatgk
    mdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshkstveynif
    egmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirskvfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kcxB (B:)
    siphitsdrllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvip
    ggidvntylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaa
    dtksccdyslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftf
    lkglgavilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrin
    cpvyitkvmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtsppl
    spdpttpdyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwd
    kavatgkmdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshks
    tveynifegmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirsk
    vfglhsvsrgmydgpvyevpatpkhaapapsaksspsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcxB (B:)
    drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvipggidvnt
    ylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaadtksccd
    yslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftflkglgav
    ilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrincpvyitk
    vmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtspplspdpttp
    dyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwdkavatgk
    mdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshkstveynif
    egmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirskvfg