PDB entry 1kcx

View 1kcx on RCSB PDB site
Description: x-ray structure of nysgrc target t-45
Deposited on 2001-11-11, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcxA (A:)
    siphitsdrllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvip
    ggidvntylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaa
    dtksccdyslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftf
    lkglgavilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrin
    cpvyitkvmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtsppl
    spdpttpdyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwd
    kavatgkmdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshks
    tveynifegmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirsk
    vfglhsvsrgmydgpvyevpatpkhaapapsaksspsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcxA (A:)
    drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvipggidvnt
    ylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaadtksccd
    yslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftflkglgav
    ilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrincpvyitk
    vmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtspplspdpttp
    dyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwdkavatgk
    mdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshkstveynif
    egmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirskvfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kcxB (B:)
    siphitsdrllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvip
    ggidvntylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaa
    dtksccdyslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftf
    lkglgavilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrin
    cpvyitkvmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtsppl
    spdpttpdyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwd
    kavatgkmdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshks
    tveynifegmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirsk
    vfglhsvsrgmydgpvyevpatpkhaapapsaksspsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcxB (B:)
    drllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvipggidvnt
    ylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaadtksccd
    yslhvditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftflkglgav
    ilvhaengdliaqeqkrilemgitgpeghalsrpeeleaeavfraiaiagrincpvyitk
    vmsksaadiialarkkgplvfgepiaaslgtdgthywsknwakaaafvtspplspdpttp
    dyltsllacgdlqvtgsghcpystaqkavgkdnftlipegvngieermtvvwdkavatgk
    mdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdkmktitakshkstveynif
    egmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpehlyqrvrirskvfg