PDB entry 1kcw

View 1kcw on RCSB PDB site
Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms
Deposited on 1996-09-25, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1kcw_ (-)
    kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
    frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
    tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
    ckkdsldkekekhidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqesnrm
    ysvngytfgslpglsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpa
    tlfdaymvaqnpgewmlscqnlnhlkaglqaffqvqecnkssskdnirgkhvrhyyiaae
    eiiwnyapsgidiftkenltapgsdsavffeqgttriggsykklvyreytdasftnrker
    gpeeehlgilgpviwaevgdtirvtfhnkgayplsiepigvrfnknnegtyyspnynpqs
    rsvppsashvaptetftyewtvpkevgptnadpvclakmyysavdptkdiftgligpmki
    ckkgslhangrqkdvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnk
    mhsmngfmygnqpgltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfp
    qtsltlhmwpdtegtfnveclttdhytggmkqkytvnqcrrqsedstfylgertyyiaav
    evewdyspqrewekelhhlqeqnvsnafldkgefyigskykkvvyrqytdstfrvpverk
    aeeehlgilgpqlhadvgdkvkiifknmatrpysihahgvqtesstvtptlpgetltyvw
    kipersgagtedsacipwayystvdqvkdlysgligplivcrrpylkvfnprrklefall
    flvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgnlqgltmhvgde
    vnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfprtpgiwllh
    chvtdhihagmettytvlqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcw_ (-)
    kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
    frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
    tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
    ckkdsldkekekhidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqesnrm
    ysvngytfgslpglsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpa
    tlfdaymvaqnpgewmlscqnlnhlkaglqaffqvqecirgkhvrhyyiaaeeiiwnyap
    sgidiftkenltapgsdsavffeqgttriggsykklvyreytdasftnrkergpeeehlg
    ilgpviwaevgdtirvtfhnkgayplsiepigvrfnknnegtyyspvppsashvaptetf
    tyewtvpkevgptnadpvclakmyysavdptkdiftgligpmkickkgslhangrqkdvd
    kefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqpglt
    mckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdtegtf
    nveclttdhytggmkqkytvnqcrrqsedstfylgertyyiaavevewdyspqrewekel
    hhlqeqnvsnafldkgefyigskykkvvyrqytdstfrvpverkaeeehlgilgpqlhad
    vgdkvkiifknmatrpysihahgvqtesstvtptlpgetltyvwkipersgagtedsaci
    pwayystvdqvkdlysgligplivcrrprrklefallflvfdeneswylddniktysdhp
    ekvnkddeefiesnkmhaingrmfgnlqgltmhvgdevnwylmgmgneidlhtvhfhghs
    fqykhrgvyssdvfdifpgtyqtlemfprtpgiwllhchvtdhihagmettytvlqn