PDB entry 1kcv

View 1kcv on RCSB PDB site
Description: Crystal structure of antibody pc282
Class: immune system
Keywords: anti-peptide antibody, fab fragment, immune system
Deposited on 2001-11-11, released 2002-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: pc282 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kcvh1, d1kcvh2
  • Chain 'L':
    Compound: pc282 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kcvl1, d1kcvl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcvH (H:)
    qvtlsqsgpglvkpsqslsltctvtsysitsdyawnwirqfagqslewmgyisysgstsy
    npslksrisitrdtsknqfflqlnsvttddtatyycarggtgfpywgtgtnvtvsaastt
    apsvfplvpgsataaasavtlgclvkgyfpepvtvawnegalssgvltvsavlqsglytl
    ssnttvasgtwpsasvtclvahpksstaadkkiepkd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcvL (L:)
    divmtqspksmgmsvgeavtlnckasenvgtyvswyqqkpgqspvlliygasnrytgvpd
    rftgsgsatdftltissvqadddadyycgqsysspltfgggtklelkradaaptssifpp
    sseqlssggasvvcflnsfypksiavkwkvdgskrangtanswtdqdsasstysmsstlt
    ltkdkyerhnsytceathktssspvvksfnrnec