PDB entry 1kcr

View 1kcr on RCSB PDB site
Description: crystal structure of antibody pc283 in complex with ps1 peptide
Deposited on 2001-11-11, released 2002-05-11
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-11, with a file datestamp of 2002-05-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.184
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcrH (H:)
    qvalqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyirnggstty
    npslasrisitrdtsknqfflqlnsvttedtatyycarggtgftywgagtlvtvsaaatt
    ppsvyplapgsaaaaaamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsalytl
    sssvtvpssprpsatvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcrL (L:)
    divltqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftlkissvqaedladyhcgqtysyptfgggtklaikradaaptvsifpps
    seqltaggasvvcflnnfypkdinvkwkidgserqngvanswtaqdsadstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec