PDB entry 1kcq

View 1kcq on RCSB PDB site
Description: Human Gelsolin Domain 2 with a Cd2+ bound
Class: structural protein
Keywords: alpha-beta structure, actin-binding protein, familial amyloidosis--Finnish type, cadmium binding, metal binding, structural protein
Deposited on 2001-11-09, released 2002-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kcqa_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcqA (A:)
    vvqrlfqvkgrrvvratevpvswesfnngdcfildlgnnihqwcgsnsnryerlkatqvs
    kgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedta