PDB entry 1kcm

View 1kcm on RCSB PDB site
Description: Crystal Structure of Mouse PITP Alpha Void of Bound Phospholipid at 2.0 Angstroms Resolution
Class: lipid binding protein
Keywords: PITP, phospholipid binding protein, phospholipid transport, LIPID BINDING PROTEIN
Deposited on 2001-11-09, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol Transfer Protein alpha
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcmA (A:)
    vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksvktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcmA (A:)
    vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksvktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqlde