PDB entry 1kcl

View 1kcl on RCSB PDB site
Description: Bacillus ciruclans strain 251 Cyclodextrin glycosyl transferase mutant G179L
Class: transferase
Keywords: glycosyltransferase, transferase, cyclodextrin
Deposited on 2001-11-09, released 2002-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.171
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyltransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot p43379 (0-685)
      • engineered (178)
    Domains in SCOPe 2.07: d1kcla1, d1kcla2, d1kcla3, d1kcla4
  • Heterogens: MAL, GLC, CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kclA (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
    indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
    liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhnlg
    tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
    sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
    yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
    gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiaygstqerwinndvli
    yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
    tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
    itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
    gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgstv
    tweggsnhtftapssgtatinvnwqp