PDB entry 1kcg

View 1kcg on RCSB PDB site
Description: NKG2D in complex with ULBP3
Class: immune system
Keywords: protein-protein complex, C-type lectin-like receptor, MHC class I-like molecule, IMMUNE SYSTEM
Deposited on 2001-11-08, released 2002-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nkg2-d type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcga_
  • Chain 'B':
    Compound: nkg2-d type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcgb_
  • Chain 'C':
    Compound: ULBP3 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcgc_
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcgA (A:)
    esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
    hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
    qrtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcgA (A:)
    sycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksyh
    wmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicmq
    rt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kcgB (B:)
    esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
    hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
    qrtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcgB (B:)
    esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
    hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
    qrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kcgC (C:)
    dahslwynftiihlprhgqqwcevqsqvdqknflsydcgsdkvlsmghleeqlyatdawg
    kqlemlrevgqrlrleladteledftpsgpltlqvrmsceceadgyirgswqfsfdgrkf
    llfdsnnrkwtvvhagarrmkekwekdsglttffkmvsmrdckswlrdflmhrkkrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcgC (C:)
    dahslwynftiihlprhgqqwcevqsqvdqknflsydcgsdkvlsmghleeqlyatdawg
    kqlemlrevgqrlrleladtepltlqvrmsceceadgyirgswqfsfdgrkfllfdsnnr
    kwtvvhagarrmkekwekdsglttffkmvsmrdckswlrdflmhrkkrle