PDB entry 1kcf

View 1kcf on RCSB PDB site
Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2
Class: hydrolase
Keywords: beta-alpha-beta motif, RuvC resolvase family, HYDROLASE
Deposited on 2001-11-08, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 30.2 kd protein c25g10.02 in chromosome I
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC25G10.02
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcfa1, d1kcfa2
  • Chain 'B':
    Compound: hypothetical 30.2 kd protein c25g10.02 in chromosome I
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC25G10.02
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcfb1, d1kcfb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcfA (A:)
    matvklsflqhickltglsrsgrkdellrrivdspiyptsrvlgidlgiknfsycfasqn
    edskviihnwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqr
    yrsgiatipewtlrvnmlesmlyalhyaekrnsieqkiqypfllslspkstysywasvln
    tkasfskkksrvqmvkelidgqkilfeneealykwnngsrvefkkddmadsaliasgwmr
    wqaqlkhyrnfckqflkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcfA (A:)
    tvklsflqhickltglsrsgrkdellrrivdspiyptsrvlgidlgiknfsycfasqned
    skviihnwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqryr
    sgiatipewtlrvnmlesmlyalhyaekrnypfllslspkstysywasvlnkksrvqmvk
    elidgqkilfeneealykwnngsrvefkkddmadsaliasgwmrwqaqlkhyrnfckqfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kcfB (B:)
    matvklsflqhickltglsrsgrkdellrrivdspiyptsrvlgidlgiknfsycfasqn
    edskviihnwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqr
    yrsgiatipewtlrvnmlesmlyalhyaekrnsieqkiqypfllslspkstysywasvln
    tkasfskkksrvqmvkelidgqkilfeneealykwnngsrvefkkddmadsaliasgwmr
    wqaqlkhyrnfckqflkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcfB (B:)
    klsflqhickltglsrsellrrivdspiyptsrvlgidlgiknfsycfasqnedskviih
    nwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqryewtlrvn
    mlesmlyalhyaekrnsieqkiqypfllslspkstysywasvlnsrvqmvkelidgqkil
    feneealykwnngefkkddmadsaliasgwmrwqaqlkhyrnfckqfl