PDB entry 1kcf

View 1kcf on RCSB PDB site
Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2
Deposited on 2001-11-08, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcfA (A:)
    tvklsflqhickltglsrsgrkdellrrivdspiyptsrvlgidlgiknfsycfasqned
    skviihnwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqryr
    sgiatipewtlrvnmlesmlyalhyaekrnsieqkiqypfllslspkstysywasvlntk
    asfskkksrvqmvkelidgqkilfeneealykwnngsrvefkkddmadsaliasgwmrwq
    aqlkhyrnfckqfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcfA (A:)
    tvklsflqhickltglsrsgrkdellrrivdspiyptsrvlgidlgiknfsycfasqned
    skviihnwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqryr
    sgiatipewtlrvnmlesmlyalhyaekrnypfllslspkstysywasvlnkksrvqmvk
    elidgqkilfeneealykwnngsrvefkkddmadsaliasgwmrwqaqlkhyrnfckqfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kcfB (B:)
    klsflqhickltglsrsgrkdellrrivdspiyptsrvlgidlgiknfsycfasqnedsk
    viihnwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqryrsg
    iatipewtlrvnmlesmlyalhyaekrnsieqkiqypfllslspkstysywasvlntkas
    fskkksrvqmvkelidgqkilfeneealykwnngsrvefkkddmadsaliasgwmrwqaq
    lkhyrnfckqfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcfB (B:)
    klsflqhickltglsrsellrrivdspiyptsrvlgidlgiknfsycfasqnedskviih
    nwsvenltekngldiqwtedfqpssmadlsiqlfntlhekfnphvilmerqryewtlrvn
    mlesmlyalhyaekrnsieqkiqypfllslspkstysywasvlnsrvqmvkelidgqkil
    feneealykwnngefkkddmadsaliasgwmrwqaqlkhyrnfckqfl