PDB entry 1kcc

View 1kcc on RCSB PDB site
Description: Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution.
Class: hydrolase
Keywords: beta helical structure, glycoside hydrolase, silver-leaf inducing substance, hydrolase
Deposited on 2001-11-08, released 2002-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endopolygalacturonase
    Species: Chondrostereum purpureum [TaxId:58369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kcca_
  • Heterogens: GTR, NAG, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kccA (A:)
    atctvksvddakdiagcsavtlngftvpagntlvlnpdkgatvtmagditfakttldgpl
    ftidgtginfvgadhifdgngalywdgkgtnngthkphpflkikgsgtykkfevlnspaq
    aisvgptdahltldgitvddfagdtknlghntdgfdvsannvtiqncivknqddciaind
    gnnirfennqcsgghgisigsiatgkhvsnvvikgntvtrsmygvrikaqrtatsasvsg
    vtydantisgiakygvlisqsypddvgnpgtgapfsdvnftggattikvnnaatrvtvec
    gncsgnwnwsqltvtggkagtiksdkakitggqyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kccA (A:)
    ctvksvddakdiagcsavtlngftvpagntlvlnpdkgatvtmagditfakttldgplft
    idgtginfvgadhifdgngalywdgkgtnngthkphpflkikgsgtykkfevlnspaqai
    svgptdahltldgitvddfagdtknlghntdgfdvsannvtiqncivknqddciaindgn
    nirfennqcsgghgisigsiatgkhvsnvvikgntvtrsmygvrikaqrtatsasvsgvt
    ydantisgiakygvlisqsypddvgnpgtgapfsdvnftggattikvnnaatrvtvecgn
    csgnwnwsqltvtggkagtiksdkakitggqyl