PDB entry 1kcb

View 1kcb on RCSB PDB site
Description: Crystal Structure of a NO-forming Nitrite Reductase Mutant: an Analog of a Transition State in Enzymatic Reaction
Class: oxidoreductase
Keywords: copper-containing nitrite reductase, BETA BARREL
Deposited on 2001-11-07, released 2003-11-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-11-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Achromobacter cycloclastes
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25006 (Start-339)
      • engineered (256)
    Domains in SCOP 1.75: d1kcba1, d1kcba2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kcbA (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphlegghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcbA (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphlegghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpasm