PDB entry 1kc7

View 1kc7 on RCSB PDB site
Description: Pyruvate Phosphate Dikinase with Bound Mg-phosphonopyruvate
Class: transferase
Keywords: TRANSFERASE, PHOSPHOTRANSFERASE, KINASE, phosphonopyruvate inhibitor
Deposited on 2001-11-07, released 2002-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate phosphate dikinase
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: PPDK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kc7a1, d1kc7a2, d1kc7a3
  • Heterogens: MG, SO4, PPR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kc7A (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc7A (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnn